PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0026800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 345aa    MW: 38222.8 Da    PI: 5.5205
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0026800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT eEde+lv+++k  G g+W+t ++  g+ R++k+c++rw +yl
   Spipo3G0026800 14 KGRWTSEEDEILVNYIKANGEGSWRTLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.23.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+e +++++  lG++ W++Ia+ ++ gRt++++k++w+++l
   Spipo3G0026800  67 RGNITPEEEEVIIKLHISLGNR-WSLIAAQLP-GRTDNEIKNHWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129417.019961IPR017930Myb domain
SuperFamilySSF466898.44E-2811108IPR009057Homeodomain-like
SMARTSM007175.6E-121363IPR001005SANT/Myb domain
PfamPF002494.0E-141461IPR001005SANT/Myb domain
CDDcd001671.26E-81661No hitNo description
PROSITE profilePS5129426.7562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2565116IPR009057Homeodomain-like
SMARTSM007179.2E-1666114IPR001005SANT/Myb domain
PfamPF002499.7E-1567112IPR001005SANT/Myb domain
CDDcd001671.17E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRAPCCQKE GLKKGRWTSE EDEILVNYIK ANGEGSWRTL PKNAGLLRCG KSCRLRWINY  60
LRSDLKRGNI TPEEEEVIIK LHISLGNRWS LIAAQLPGRT DNEIKNHWNS HLSRRIHRLR  120
RLDGDDGPAV IMDLGKIVGI PCRRRGGRMS RSAMKKESTV GTVDKGQHGQ GGPDGESEKT  180
AQPTCGRPVE FPSKKVNPEA LPACEPPETD PSLPTEFWET ASELLSPSWE RGDGGWSAAS  240
SFIEQRESGP SMSSCTTSEE RKDGTMPVVA HQPYAQADEC NSTGTTGGGW LDVELEAIAT  300
KLWDEAGEAW PWQWEDASVV DLQSHQRPTD CCEYERGALE SWLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0TPA05e-80M0TPA0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P10470_0011e-79(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.16e-63myb domain protein 12